Loading...
Statistics
Advertisement

Tasty Kitchen, Outside Catering & Coffee - Leeds- Tasty
www.tastyleeds.co.uk/
An indepenendant cafe and outside catering business in Leeds. We use locally sourced ingredients to make our delicious homemade burgers, salads ...

Tastyleeds.co.uk

Domain is redirected to: Tastyleeds.com
Advertisement
Conversion Technology Metas Server
Tastyleeds.co.uk is hosted in United States / New York . Tastyleeds.co.uk doesn't use HTTPS protocol. Number of used technologies: 6. First technologies: CSS, Html, Javascript, Number of used javascripts: 4. First javascripts: L4Fn4eJb3uJlVjH...Mg6sJMJ.js, ?rafscroll.js&m...js&site.js, Number of used analytics tools: 0. Its server type is: Microsoft-IIS/7.5. Its CMS is: Squarespace.

Technologies in use by Tastyleeds.co.uk

Technology

Number of occurences: 6
  • CSS
  • Html
  • Javascript
  • Lightbox
  • Php
  • SVG

Advertisement

Javascripts

Number of occurences: 4
  • L4Fn4eJb3uJlVjHnakNABo0FAugcUh2ZPvyxdxtaJ09felXgfFHN4UJLFRbh52jhWD9D5QmRwQMuZQsKw2wkZ2SoFhZcFRSoFUTdiaiaO1sySasodem8ZYw0jhNlOYsySasodem8ZYw0jhNlOYsySasoOAU8ZAsDO1FUiABkZWF3jAF8OcFzdP37O1sySasoOAU8ZAsDO1FUiABkZWF3jAF8OcFzdPJwSY4zpe8ljPu0daZyH6qJtKGbMg62JMJ7fbKzMsMMeMb6MKG4fHXgIMMjgKMfH6qJK3IbMg6YJMJ7fbRRHyMMeMX6MKG4fHtgIMMjIfMfH6qJRMIbMg6sJMJ.js
  • ?rafscroll.js&mutation-observer.js&site.js

Content Management System

Number of occurences: 1
  • Squarespace

Server Type

  • Microsoft-IIS/7.5

Powered by

  • ASP.NET

Conversion rate optimization
visitors Clickable call number Not founded!
visitors Conversion form (contact form, subcriber) Founded!
visitors Clickable email Not founded!
visitors CTA (call to action) button Founded!
visitors List Founded!
visitors Image Not founded!
visitors Enhancement Not founded!
visitors Responsive website Founded!
visitors Facebook sharing Not founded!
visitors Google+ sharing Not founded!
visitors Twitter sharing Not founded!
visitors Linkedin sharing Not founded!
visitors Blog on the webiste Not founded!

HTTPS (SSL) - Tastyleeds.co.uk

Missing HTTPS protocol.

    Meta - Tastyleeds.co.uk

    Number of occurences: 7
    • Name:
      Content: http://static1.squarespace.com/static/5395c105e4b032d797ff6797/t/547ca174e4b0d64f97acf29e/1464873027110/?format=1000w
    • Name: viewport
      Content: width=device-width,initial-scale=1
    • Name: twitter:title
      Content: Tasty Leeds | Catering Leeds | Leeds Catering | Coffee | Breakfast | Lunch
    • Name: twitter:image
      Content: http://static1.squarespace.com/static/5395c105e4b032d797ff6797/t/547ca174e4b0d64f97acf29e/1464873027110/?format=1000w
    • Name: twitter:url
      Content: http://www.tastyleeds.com/
    • Name: twitter:card
      Content: summary
    • Name: description
      Content: An indepenendant cafe and outside catering business in Leeds. We use locally sourced ingredients to make our delicious homemade burgers, salads, sandwiches, breakfasts, coffee and cakes.

    Server / Hosting

    • IP: 198.49.23.145
    • Latitude: 40.72
    • Longitude: -74.01
    • Country: United States
    • City: New York

    Rname

    • ns.123-reg.co.uk
    • ns2.123-reg.co.uk
    • MX0.123-REG.co.uk
    • MX1.123-REG.co.uk

    Target

    • hostmaster.tastyleeds.co.uk

    HTTP Header Response

    HTTP/1.1 301 Moved Permanently Cache-Control: private Content-Length: 0 Location: http://www.tastyleeds.com Server: Microsoft-IIS/7.5 X-AspNet-Version: 2.0.50727 X-Powered-By: ASP.NET Date: Mon, 20 Jun 2016 10:27:01 GMT X-Cache: MISS from s_xt27 X-Cache-Lookup: MISS from s_xt27:80 Via: 1.1 s_xt27 (squid/3.5.6) Connection: keep-alive HTTP/1.1 200 OK Date: Mon, 20 Jun 2016 10:27:02 GMT X-ServedBy: web116 Set-Cookie: crumb=AbDDhfvePFrtIRCMvIQRQgBBMi3kapxT;Path=/ Expires: Thu, 01 Jan 1970 00:00:00 GMT Set-Cookie: SS_MID=1317d143-630e-439e-8d95-7a543612f740ipnvo0j0;Path=/;Domain=.tastyleeds.com;Expires=Thu, 18-Jun-2026 10:27:02 GMT Accept-Ranges: bytes Content-Type: text/html; charset=UTF-8 X-PC-AppVer: 8102 X-PC-Date: Mon, 20 Jun 2016 09:55:36 GMT X-PC-Host: 10.120.201.114 ETag: W/"a3658babf32fc6a68219c9d28dbbe85e" X-PC-Key: uIfqpUpIkBPVyeHRTSuO3CwFpxc-tasty-leeds X-PC-Hit: true X-ContextId: FB4wt6o1/3u3QHpXs X-Via: 1.1 echo004 X-Cache: MISS from s_xt27 X-Cache-Lookup: MISS from s_xt27:80 Via: 1.1 s_xt27 (squid/3.5.6) Connection: keep-alive

    DNS

    host: tastyleeds.co.uk
    1. class: IN
    2. ttl: 14400
    3. type: A
    4. ip: 94.136.40.82
    host: tastyleeds.co.uk
    1. class: IN
    2. ttl: 14400
    3. type: NS
    4. target: ns.123-reg.co.uk
    host: tastyleeds.co.uk
    1. class: IN
    2. ttl: 14400
    3. type: NS
    4. target: ns2.123-reg.co.uk
    host: tastyleeds.co.uk
    1. class: IN
    2. ttl: 14400
    3. type: SOA
    4. mname: ns.123-reg.co.uk
    5. rname: hostmaster.tastyleeds.co.uk
    6. serial: 2011051901
    7. refresh: 86400
    8. retry: 3600
    9. expire: 1209600
    10. minimum-ttl: 14400
    host: tastyleeds.co.uk
    1. class: IN
    2. ttl: 14400
    3. type: MX
    4. pri: 10
    5. target: MX0.123-REG.co.uk
    host: tastyleeds.co.uk
    1. class: IN
    2. ttl: 14400
    3. type: MX
    4. pri: 20
    5. target: MX1.123-REG.co.uk

    Common Typos/Mistakes

    This list shows You some spelling mistakes at internet search for this domain.

    www.astyleeds.co.uk, www.tqastyleeds.co.uk, www.qastyleeds.co.uk, www.taastyleeds.co.uk, www.aastyleeds.co.uk, www.t astyleeds.co.uk, www. astyleeds.co.uk, www.twastyleeds.co.uk, www.wastyleeds.co.uk, www.teastyleeds.co.uk, www.eastyleeds.co.uk, www.tzastyleeds.co.uk, www.zastyleeds.co.uk, www.txastyleeds.co.uk, www.xastyleeds.co.uk, www.tcastyleeds.co.uk, www.castyleeds.co.uk, www.tstyleeds.co.uk, www.taostyleeds.co.uk, www.tostyleeds.co.uk, www.tapstyleeds.co.uk, www.tpstyleeds.co.uk, www.ta9styleeds.co.uk, www.t9styleeds.co.uk, www.tastyleeds.co.uk, www.tstyleeds.co.uk, www.taistyleeds.co.uk, www.tistyleeds.co.uk, www.taustyleeds.co.uk, www.tustyleeds.co.uk, www.tatyleeds.co.uk, www.tasetyleeds.co.uk, www.taetyleeds.co.uk, www.taswtyleeds.co.uk, www.tawtyleeds.co.uk, www.tasdtyleeds.co.uk, www.tadtyleeds.co.uk, www.tasxtyleeds.co.uk, www.taxtyleeds.co.uk, www.tasftyleeds.co.uk, www.taftyleeds.co.uk, www.tasgtyleeds.co.uk, www.tagtyleeds.co.uk, www.tasttyleeds.co.uk, www.tattyleeds.co.uk, www.tasyleeds.co.uk, www.tastqyleeds.co.uk, www.tasqyleeds.co.uk, www.tastayleeds.co.uk, www.tasayleeds.co.uk, www.tast yleeds.co.uk, www.tas yleeds.co.uk, www.tastwyleeds.co.uk, www.taswyleeds.co.uk, www.tasteyleeds.co.uk, www.taseyleeds.co.uk, www.tastzyleeds.co.uk, www.taszyleeds.co.uk, www.tastxyleeds.co.uk, www.tasxyleeds.co.uk, www.tastcyleeds.co.uk, www.tascyleeds.co.uk, www.tastleeds.co.uk, www.tastyzleeds.co.uk, www.tastzleeds.co.uk, www.tastyaleeds.co.uk, www.tastaleeds.co.uk, www.tastysleeds.co.uk, www.tastsleeds.co.uk, www.tastydleeds.co.uk, www.tastdleeds.co.uk, www.tastyleeds.co.uk, www.tastleeds.co.uk, www.tastycleeds.co.uk, www.tastcleeds.co.uk, www.tasty leeds.co.uk, www.tast leeds.co.uk, www.tastyeeds.co.uk, www.tastylueeds.co.uk, www.tastyueeds.co.uk, www.tastyl8eeds.co.uk, www.tasty8eeds.co.uk, www.tastyl9eeds.co.uk, www.tasty9eeds.co.uk, www.tastyljeeds.co.uk, www.tastyjeeds.co.uk, www.tastyl0eeds.co.uk, www.tasty0eeds.co.uk, www.tastylmeeds.co.uk, www.tastymeeds.co.uk, www.tastylpeeds.co.uk, www.tastypeeds.co.uk, www.tastyloeeds.co.uk, www.tastyoeeds.co.uk, www.tastyleds.co.uk, www.tastylexeds.co.uk, www.tastylxeds.co.uk, www.tastyleseds.co.uk, www.tastylseds.co.uk, www.tastyleweds.co.uk, www.tastylweds.co.uk, www.tastylereds.co.uk, www.tastylreds.co.uk, www.tastylefeds.co.uk, www.tastylfeds.co.uk, www.tastyleveds.co.uk, www.tastylveds.co.uk, www.tastyleceds.co.uk, www.tastylceds.co.uk, www.tastyleqeds.co.uk, www.tastylqeds.co.uk, www.tastyleaeds.co.uk, www.tastylaeds.co.uk, www.tastyleyeds.co.uk, www.tastylyeds.co.uk, www.tastyleds.co.uk, www.tastyleexds.co.uk, www.tastylexds.co.uk, www.tastyleesds.co.uk, www.tastylesds.co.uk, www.tastyleewds.co.uk, www.tastylewds.co.uk, www.tastyleerds.co.uk, www.tastylerds.co.uk, www.tastyleefds.co.uk, www.tastylefds.co.uk, www.tastyleevds.co.uk, www.tastylevds.co.uk, www.tastyleecds.co.uk, www.tastylecds.co.uk, www.tastyleeqds.co.uk, www.tastyleqds.co.uk, www.tastyleeads.co.uk, www.tastyleads.co.uk, www.tastyleeyds.co.uk, www.tastyleyds.co.uk, www.tastylees.co.uk, www.tastyleedts.co.uk, www.tastyleets.co.uk, www.tastyleedgs.co.uk, www.tastyleegs.co.uk, www.tastyleedbs.co.uk, www.tastyleebs.co.uk, www.tastyleedxs.co.uk, www.tastyleexs.co.uk, www.tastyleedss.co.uk, www.tastyleess.co.uk, www.tastyleedfs.co.uk, www.tastyleefs.co.uk, www.tastyleedvs.co.uk, www.tastyleevs.co.uk, www.tastyleedys.co.uk, www.tastyleeys.co.uk, www.tastyleedzs.co.uk, www.tastyleezs.co.uk, www.tastyleedas.co.uk, www.tastyleeas.co.uk, www.tastyleedes.co.uk, www.tastyleees.co.uk, www.tastyleedrs.co.uk, www.tastyleers.co.uk,

    Other websites we recently analyzed

    1. 12345.net.cn
      Fremont (United States) - 184.105.178.89
      Server software: Tengine/1.4.2
      Technology: Google Adsense, Html, Javascript, Php
      Number of Javascript: 2
      Number of meta tags: 1
    2. newyorkmedicalmalpracticelawyer.net
      Dover (United States) - 192.230.92.93
      Server software:
      Technology: Html, Iframe, Incapsula, Javascript
      Number of Javascript: 1
      Number of meta tags: 4
    3. COBILIGHT Willkommen bei der COBILIGHT Vertrieb GmbH
      Sparen Sie ab sofort Stromkosten und wechseln Sie mit COBILight Vertriebs GmbH auf umweltschonende und energieeffiziente Beleuchtungssysteme!
      Germany - 5.9.101.99
      Server software: Apache
      Technology: CSS, Google Font API, Html, Javascript, Php, Google +1 Button
      Number of Javascript: 6
      Number of meta tags: 13
    4. tatutaao.com
      Beijing (China) - 117.79.148.162
      Server software: Apache/2
      Technology: Html
    5. dawsonvilledoctor.com
      New York (United States) - 69.172.201.153
      Server software: DOSarrest
      Technology: Html, Javascript
      Number of meta tags: 1
    6. Guda
      Slovenia - 91.240.216.11
      Server software: Apache
      Technology: CSS, Google Font API, Html, Html5, jQuery, Php, Pingback, Wordpress
      Number of Javascript: 6
      Number of meta tags: 4
    7. www.885509.net
      Kowloon (Hong Kong) - 123.1.156.80
      Server software: nginx/1.0.15
      Technology: CSS, Html, Javascript, Php
      Number of Javascript: 1
      Number of meta tags: 1
    8. Peering Exchange Hub India | Internet Exchange Point | Mumbai CH
      Mumbai CH is India's largest peering hub, offering neutral internet and peering exchange services through various traffic exchange points. Contact Us Now!
      Mumbai (India) - 206.183.111.214
      G Analytics ID: UA-79664070-1
      Server software: Microsoft-IIS/7.5
      Technology: CSS, Html, Javascript, Php, Google Analytics, Facebook Box, Google +1 Button
      Number of Javascript: 4
      Number of meta tags: 3
    9. Lanisky Data Center
      Scottsdale (United States) - 107.180.41.43
      Server software: Apache/2.4.18
      Technology: CSS, Html, Javascript
      Number of Javascript: 1
      Number of meta tags: 2
    10. Stassek Home Pferdepflege Lederpflege Hundepflege Waschmittel Haushalt Freizeit Glanzspray Pflege Reitsport Reiter Reiterin Stall Kosmetik Fellglanz www.stassek.com
      Equistar und viele weitere Produkte für Pferdepflege, Lederpflege, Hundepflege, Haushalt und Freizeit - Weltmaßstäbe in Pflegeprodukten seit 1981. Ahaus
      Germany - 217.160.223.176
      Server software: Apache
      Technology: CSS, Php
      Number of meta tags: 7

    Check Other Websites